General Information

  • ID:  hor004161
  • Uniprot ID:  Q969E3(120-157)
  • Protein name:  Urocortin-3
  • Gene name:  UCN3
  • Organism:  Homo sapiens (Human)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  Human
  • Expression:  human placenta decidua, fetal membranes,heart and kidney
  • Disease:  Diseases associated with UCN3 include Mixed Sleep Apnea and Major Depressive Disorder.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding; GO:0051429 corticotropin-releasing hormone receptor binding; GO:0051431 corticotropin-releasing hormone receptor 2 binding
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007586 digestion; GO:0009749 response to glucose; GO:0009755 hormone-mediated signaling pathway; GO:0031669 cellular response to nutrient levels; GO:0032024 positive regulation of insulin secretion; GO:0035902 response to immobilization stress; GO:0042594 response to starvation; GO:0045838 positive regulation of membrane potential; GO:0051412 response to corticosterone; GO:0071456 cellular response to hypoxia
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030424 axon; GO:0043196 varicosity; GO:0043679 axon terminus

Sequence Information

  • Sequence:  FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
  • Length:  38(120-157)
  • Propeptide:  MLMPVHFLLLLLLLLGGPRTGLPHKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFHYLRSRDASSGEEEEGKEKKTFPISGARGGARGTRYRYVSQAQPRGKPRQDTAKSPHRTKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK
  • Signal peptide:  MLMPVHFLLLLLLLLGGPRTG
  • Modification:  T38 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Suppresses food intake, delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress;may be proposed as regulators of placental vascular endothelial tone
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  CRHR2, CRHR1
  • Target Unid:  Q13324, P34998
  • IC50: NA
  • EC50: cAMP rCRF-R2-alpha:0.16nmol;cAMP mCRF-R2-beta:0.12nmol
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  2rmh(PDB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    2rmh.pdbhor004161_AF2.pdbhor004161_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 479910 Formula: C185H306N52O51S2
Absent amino acids: CEGWY Common amino acids: A
pI: 10.79 Basic residues: 4
Polar residues: 8 Hydrophobic residues: 20
Hydrophobicity: 44.74 Boman Index: -1876
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 121.05
Instability Index: 4005.79 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  15949638
  • Title:  Urocortin 3/stresscopin in Human Colon: Possible Modulators of Gastrointestinal Function During Stressful Conditions.
  • PubMed ID:  16626608
  • Title:  Urocortin 2 and Urocortin 3 Are Expressed by the Human Placenta, Deciduas, and Fetal Membranes
  • PubMed ID:  15070962
  • Title:  Expression of Urocortin III/stresscopin
  • PubMed ID:  11416224
  • Title: